Protein Info for GFF4555 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04390: LptE
  • amino acids 34 to 159 (126 residues), 67.6 bits, E=7.8e-23

Best Hits

Swiss-Prot: 100% identical to LPTE_SALTY: LPS-assembly lipoprotein LptE (lptE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03643, LPS-assembly lipoprotein (inferred from 98% identity to sty:STY0698)

MetaCyc: 100% identical to LPS assembly lipoprotein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B)" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

• Salmonella typhimurium LT2 lipopolysaccharide biosynthesis (final steps) (2/2 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.5

Protein Sequence (196 amino acids)

>GFF4555 LPS-assembly lipoprotein RlpB precursor (Rare lipoprotein B) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
VRYLVTLLLSLAVLVTAGCGWHLRSTTQVPASMKTMILDSGDPNGPLSRAVRNQLRLNNV
NLLDKDTTRKDVPSLRLGTVTILQDTASVFQDGQTAEYQMVMTVNASVLIPGHDIYPIST
KVYRSFFDNPQMALAKDNEQAMIVQEMYDKAAEQLIRKLTSVRAADIQATKEEATADNET
AAPASTPARVSTTLSN