Protein Info for GFF4552 in Sphingobium sp. HT1-2

Annotation: Glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13439: Glyco_transf_4" amino acids 44 to 209 (166 residues), 90.4 bits, see alignment E=4.1e-29 PF13579: Glyco_trans_4_4" amino acids 45 to 200 (156 residues), 51.2 bits, see alignment E=5.5e-17 PF00534: Glycos_transf_1" amino acids 219 to 379 (161 residues), 93.3 bits, see alignment E=3.9e-30 PF13692: Glyco_trans_1_4" amino acids 235 to 367 (133 residues), 100.9 bits, see alignment E=2.4e-32 PF13524: Glyco_trans_1_2" amino acids 275 to 392 (118 residues), 27.6 bits, see alignment E=7.9e-10

Best Hits

KEGG orthology group: None (inferred from 58% identity to swi:Swit_3802)

Predicted SEED Role

"Glycosyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>GFF4552 Glycosyltransferase (Sphingobium sp. HT1-2)
MTLHSPLSSLRAHIHAALPVAAASASSRPLKIALFSGNYDCVRDGANRALNRLVRHMLDE
HKAEVRIYSPTAPTPAFASAGDVRSVRSLCIPGRPEYRLAIGLTRAARADLEAFQPDIVH
LSAPDLLGRQALNWARGNAVPTVASLHTRFETYLAYYRLGFLRRQVEAYLDRFYGDCDRI
LAPTPLIGADLAAIHGAERIALWSRGVDRSVFHPAMRDESLRAQLGYAPDDVVPLFFGRL
VREKGLDIFADAIMAARASGLSLRPLILGDGPARDALARHLPNASFAGHVEGARLGALVA
SADILVNPSITEAFGNVNLEAMASGLAVLSADVPSASALIDNGVNGLLVPPGDVGAYARG
LASLVRDTGLRRRLGRAAEATAGDYRWDHVLDSVARVYRELAGAPME