Protein Info for GFF4550 in Variovorax sp. SCN45

Annotation: NAD(FAD)-utilizing dehydrogenase, sll0175 homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 561 transmembrane" amino acids 114 to 134 (21 residues), see Phobius details PF01494: FAD_binding_3" amino acids 114 to 285 (172 residues), 23.2 bits, see alignment E=9.5e-09 PF21688: FAD-depend_C" amino acids 303 to 498 (196 residues), 273.1 bits, see alignment E=4.9e-85

Best Hits

KEGG orthology group: K07137, (no description) (inferred from 94% identity to vpe:Varpa_0904)

Predicted SEED Role

"NAD(FAD)-utilizing dehydrogenase, sll0175 homolog"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (561 amino acids)

>GFF4550 NAD(FAD)-utilizing dehydrogenase, sll0175 homolog (Variovorax sp. SCN45)
MRGLLDNYKPYAAMLRISELKLPLDHAPDALAALIARTLDVPLDAIASHNVYKRSFDARK
VELLTVYICDVQLADAKLEAALLAKHTGHPHIQKAPDMRYTPPANAPEGTARPVVIGFGP
CGIFAALMLAKMGFRPIVLERGKTVRQRTRDTWGLWRKSVLNPESNVQFGEGGAGTFSDG
KLYSQIKDPRFLGRKVMEEFVKAGAPPEILYVAHPHIGTFKLVKVVENIREQIVALGGEI
RFEQRVTDVHIENGHLRGLTVLDQTTGQSHELRADHVVMALGHSSRDTFEMLHARGVHIE
AKPFSIGFRVEHPQGLIDRARWGRHAGHPLLGAADYKLVHHASNGRSVYSFCMCPGGTVV
AATSEPGRVVTNGMSQYSRNERNANAGIVVGIDPRDYPGDALAGIALQRELESNAFVLGG
GDYRAPGQLVGDFIAGKPSTALGSVTPSYKPGVTPTDLHKALPAYAIEAMREAFPAFGRK
IKGFDTHDAVLTGVETRTSSPIKITRGDDFQSLNVRGLYPAGEGASYAGGILSAGVDGIK
VAEAVAHSVLAESERERTANV