Protein Info for GFF455 in Sphingobium sp. HT1-2

Annotation: putative dioxygenase ferredoxin subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 109 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF13806: Rieske_2" amino acids 11 to 107 (97 residues), 58.9 bits, see alignment E=4.3e-20 PF00355: Rieske" amino acids 12 to 97 (86 residues), 73.2 bits, see alignment E=1.4e-24

Best Hits

Swiss-Prot: 34% identical to NAGAB_RALSP: Naphthalene 1,2-dioxygenase/salicylate 5-hydroxylase systems, ferredoxin component (nagAb) from Ralstonia sp.

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 45% identity to swi:Swit_2251)

MetaCyc: 32% identical to naphthalene 1,2-dioxygenase complex ferredoxin component (Pseudomonas sp. NCIB9816-4)
Naphthalene 1,2-dioxygenase. [EC: 1.14.12.12]

Predicted SEED Role

"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (109 amino acids)

>GFF455 putative dioxygenase ferredoxin subunit (Sphingobium sp. HT1-2)
MMNGAMTMLTFTAVAHVDDVPPGTAKAVDVDGESILLCHSNGRLFAVANRCSHADEPLAC
GRVRAGWIACPVHGARFDLETGRAMNPPAKAPIRVYELRIVDDRIEIAR