Protein Info for GFF4548 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Glutathione-regulated potassium-efflux system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 PF00005: ABC_tran" amino acids 17 to 178 (162 residues), 81.7 bits, see alignment E=2.4e-26 amino acids 336 to 477 (142 residues), 78.2 bits, see alignment E=2.8e-25 PF12848: ABC_tran_Xtn" amino acids 217 to 296 (80 residues), 94.8 bits, see alignment E=8.3e-31 PF16326: ABC_tran_CTD" amino acids 594 to 655 (62 residues), 41.2 bits, see alignment E=4.5e-14

Best Hits

KEGG orthology group: K06158, ATP-binding cassette, sub-family F, member 3 (inferred from 72% identity to pna:Pnap_1808)

Predicted SEED Role

"Glutathione-regulated potassium-efflux system ATP-binding protein" in subsystem Glutathione-regulated potassium-efflux system and associated functions or Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>GFF4548 Glutathione-regulated potassium-efflux system ATP-binding protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MITLKNVVLRRGAKVLLDGASCTINPGEKVGLVGRNGAGKSSLFRLLDGTLHEDKGDFNV
PQQWRMAQVAQDMPETDMSATQFVIEGDSTLLKAQEEVTAAEDSGDGERMAHAYMALHDA
GAHDAPARAQALILGLGFRIDELERPVDSFSGGWRMRLQLARALMCPSELLLLDEPTNHL
DLDALVWLEAWLKRYDGTLLVISHDREFLDAITNVTVHIERALLNRYGGNYSRFEDMRAE
QMALQATSYARQQEKMAHLQKFIDRFKAKASKAKQAQSRVKALERMEKIGPVLAEADFNF
EFSEPQNLPNPMLAMEGVTFGYPPREPGGEPVAIVRGISRSVLAGQRIGILGANGQGKST
VVKTIARDLQALAGQITEGKGLNIGYFAQQELDVLRPADTPLEHMIRLVRDCTAQGRLSG
QPTREQDLRSFLGSFNFTGDQVKQSVGSMSGGEKARLVLCMIVWQRPNLLLLDEPTNHLD
LATREALSVALNEFEGTVMLVSHDRALLRAVCDEFWLVSRGGIEPFDGDLDDYQRYLLDV
AKQSREAQRQEQRGQQAAPPPAAAAPKAPEPARAPDQKRQDAQRRQQLAEKTRPLKKELE
QTEKRMAQLAQEKTRLEAAMSQPASPADIAESGRRLKAVNDENDALEARWLELHEAIEGA