Protein Info for GFF4546 in Xanthobacter sp. DMC5

Annotation: Short-chain-enoyl-CoA hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 20 to 262 (243 residues), 180.5 bits, E=3.9e-57
• PF16113: ECH_2
  • amino acids 24 to 203 (180 residues), 112.6 bits, E=2.9e-36

Best Hits

Swiss-Prot: 36% identical to PAAF_ECOLI: 2,3-dehydroadipyl-CoA hydratase (paaF) from Escherichia coli (strain K12)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 44% identity to sco:SCO0364)

MetaCyc: 35% identical to 3-hydroxypropionyl-CoA dehydratase (Metallosphaera sedula)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase (EC 4.2.1.17)" in subsystem Acetyl-CoA fermentation to Butyrate or Butanol Biosynthesis or Isoleucine degradation or Polyhydroxybutyrate metabolism or Valine degradation or n-Phenylalkanoic acid degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (28/35 steps found)
• phenylacetate degradation I (aerobic) (9/9 steps found)
• superpathway of phenylethylamine degradation (10/11 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (21/27 steps found)
• adipate degradation (5/5 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• acrylate degradation II (3/3 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• fatty acid salvage (5/6 steps found)
• 3-hydroxypropanoate cycle (10/13 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• β-alanine biosynthesis II (4/6 steps found)
• L-isoleucine degradation I (4/6 steps found)
• propanoate fermentation to 2-methylbutanoate (4/6 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• superpathway of Clostridium acetobutylicum acidogenic fermentation (6/9 steps found)
• glycerol degradation to butanol (11/16 steps found)
• acrylate degradation I (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (3/5 steps found)
• glutaryl-CoA degradation (3/5 steps found)
• propanoyl-CoA degradation II (3/5 steps found)
• L-valine degradation I (5/8 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (12/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (12/18 steps found)
• pyruvate fermentation to butanoate (4/7 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• L-glutamate degradation V (via hydroxyglutarate) (6/10 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• glyoxylate assimilation (8/13 steps found)
• valproate β-oxidation (5/9 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (3/7 steps found)
• 3-phenylpropanoate degradation (5/10 steps found)
• superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (10/17 steps found)
• superpathway of Clostridium acetobutylicum solventogenic fermentation (7/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (4/9 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
• pyruvate fermentation to butanol I (3/8 steps found)
• gallate degradation III (anaerobic) (5/11 steps found)
• L-glutamate degradation VII (to butanoate) (5/12 steps found)
• L-tryptophan degradation III (eukaryotic) (4/15 steps found)
• benzoate fermentation (to acetate and cyclohexane carboxylate) (5/17 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• crotonate fermentation (to acetate and cyclohexane carboxylate) (4/16 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• toluene degradation VI (anaerobic) (3/18 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Protein Sequence (263 amino acids)

>GFF4546 Short-chain-enoyl-CoA hydratase (Xanthobacter sp. DMC5)
MSDTSTGDPGTDGAIRITHEGAVARLVIDRPRKHNAITPAMARDLAAACAALDADEQVRV
VLLTGGGEKAFSAGSDMNALGEITDLWAFRNRVEYAAVVRDMRKPVIALLRGWVLGGGLE
IALGADIRIAGTSAKFGAPEVTRGWVGGGGASQMLPRLVGYGQAMRLLLSGDTIDAERAR
AIGLVEEVIEDDALDTHATALAQRIATFSPLATQAVKAATRAALSMPLEAGIRHENELHV
ICMSDRGRQEGITAFQEGREGRF