Protein Info for PS417_23240 in Pseudomonas simiae WCS417

Annotation: preprotein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02699: YajC
  • amino acids 27 to 101 (75 residues), 96.9 bits, E=2.6e-32
• TIGR00739: preprotein translocase, YajC subunit
  • amino acids 27 to 104 (78 residues), 93.9 bits, E=2.5e-31

Best Hits

Swiss-Prot: 49% identical to YAJC_ECOLI: Sec translocon accessory complex subunit YajC (yajC) from Escherichia coli (strain K12)

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 100% identity to pfs:PFLU5076)

MetaCyc: 49% identical to Sec translocon accessory complex subunit YajC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

See A0A1N7U6B2 at UniProt or InterPro

Protein Sequence (112 amino acids)

>PS417_23240 preprotein translocase subunit YajC (Pseudomonas simiae WCS417)
MSFFISNAMADAAAPAAAGPMGGGFEWIFLVGFLVIFYLMIWRPQAKRAKEQKNLLGSLQ
KGDEVVTTGGIAGKITKVSDAFVVLEVSDTVEMKFQKGAIAATLPKGTLKAI