Protein Info for GFF4537 in Xanthobacter sp. DMC5

Annotation: Anthranilate 1,2-dioxygenase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 PF13577: SnoaL_4" amino acids 18 to 156 (139 residues), 48.6 bits, see alignment E=8.4e-17 PF00866: Ring_hydroxyl_B" amino acids 33 to 162 (130 residues), 58.8 bits, see alignment E=6.4e-20

Best Hits

Swiss-Prot: 39% identical to NAGH_RALSP: Salicylate 5-hydroxylase, small oxygenase component (nagH) from Ralstonia sp.

KEGG orthology group: K05709, small terminal subunit of phenylpropionate dioxygenase [EC: 1.14.12.19] (inferred from 46% identity to bpa:BPP0273)

MetaCyc: 43% identical to 6-hydroxypicolinate 3-monooxygenase subunit 4 (Alcaligenes faecalis)
1.14.13.-

Predicted SEED Role

"Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA" in subsystem Benzoate degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (173 amino acids)

>GFF4537 Anthranilate 1,2-dioxygenase small subunit (Xanthobacter sp. DMC5)
MLNPASANAPSRDDLIDALLLKAEVEAFNEAYASALDEQRLADWAEMFTVNGFYNIISRE
NYDRKLPVGLIYCENRGMIRDRAFALEKTAMFAPRYLRHMVGNIKVAEAADGSIDATANY
VVFQVLFDRPDATIHQVGRYIDRFVREEGGLKLASRVCIYDSLLIDNALCIPV