Protein Info for GFF4535 in Variovorax sp. SCN45

Annotation: Tetrapartite efflux system, membrane fusion component FusE-like

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 312 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 54 to 240 (187 residues), 101.1 bits, see alignment E=3.1e-33 PF25917: BSH_RND" amino acids 54 to 193 (140 residues), 44.1 bits, see alignment E=2.3e-15 PF25878: HH_AAEA_pHBA" amino acids 89 to 160 (72 residues), 29.1 bits, see alignment E=1.7e-10 PF25963: Beta-barrel_AAEA" amino acids 197 to 293 (97 residues), 128.6 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 41% identical to AAEA_YERE8: p-hydroxybenzoic acid efflux pump subunit AaeA (aaeA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: None (inferred from 88% identity to vpe:Varpa_0911)

MetaCyc: 40% identical to aromatic carboxylic acid efflux pump membrane fusion protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-233

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (312 amino acids)

>GFF4535 Tetrapartite efflux system, membrane fusion component FusE-like (Variovorax sp. SCN45)
MKAARPSSDNPWVQRLGRVLFTVLVVAAAVWAGLRLWDHYELAPWTRDGRVRANVVQIAP
DVSGLVTAVPIRDNQPVAAGTLLFEVDRARYDLAVRQAQAALSAQRAMSAQVQRENARNA
GLDDLVSKESREQTRSRVEQMQAAVAQAEVALDSAKLNLQRAEVRAPTSGLVTNLDLRQG
SYAAAGRPVLALVDAQSFYVEGYFEETKLPRIHLGDRVRVTPMGGGAVLEGAVDSVAAGI
ADHDRSTSANLLPSVNPTFNWVRLAQRIPVRIKLDPLPQGARLVAGQTVTVQVLENKPAQ
KTAATATTPRKG