Protein Info for GFF4535 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details amino acids 54 to 76 (23 residues), see Phobius details amino acids 96 to 119 (24 residues), see Phobius details amino acids 149 to 165 (17 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 191 to 207 (17 residues), see Phobius details amino acids 217 to 238 (22 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 319 to 340 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 16 to 335 (320 residues), 68.9 bits, see alignment E=2.2e-23

Best Hits

KEGG orthology group: None (inferred from 71% identity to sjp:SJA_C1-25030)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>GFF4535 hypothetical protein (Sphingobium sp. HT1-2)
LPDIVLANATRRSDAIAIARVICILGVVYVHAWTGRNGQDLELLRGSPQEGLRWVLMEIF
GRSAVPLLGLISGWLVGGSARTRNWLDHVGRKARTILLPMLLWNAVAILLVSGAAWLLGL
SAPVPQSGGWIAEELFIINRNPDINVQMPFLRDLFLCMVAAPLLVRLPNWMLMAVALAAL
SCQIAGLGPPVLMRPSILFFFTIGILARREGWADRAAAVPMLAASLPFGLLMGAQLYVSL
KGGAGLAPLALACLDMAVRMAASLCFWRLAWALAESPARGLLMRVEPYAFFLFCAHLILI
WLGGPLLGQLFGPLGSPLYPLYLIAQPFLVLAVVILIGNLMQRLSPTMAGLMSGGRLAAT