Protein Info for PS417_23205 in Pseudomonas simiae WCS417

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 163 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details TIGR02010: iron-sulfur cluster assembly transcription factor IscR" amino acids 1 to 134 (134 residues), 220.9 bits, see alignment E=4.5e-70 TIGR00738: Rrf2 family protein" amino acids 1 to 130 (130 residues), 157.6 bits, see alignment E=1.5e-50 PF02082: Rrf2" amino acids 3 to 131 (129 residues), 134.7 bits, see alignment E=1.2e-43

Best Hits

Swiss-Prot: 80% identical to YOR2_AZOVI: Putative HTH-type transcriptional regulator ORF2 from Azotobacter vinelandii

KEGG orthology group: K13643, Rrf2 family transcriptional regulator, iron-sulfur cluster assembly transcription factor (inferred from 98% identity to pfo:Pfl01_4613)

Predicted SEED Role

"Iron-sulfur cluster regulator IscR" in subsystem Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U183 at UniProt or InterPro

Protein Sequence (163 amino acids)

>PS417_23205 transcriptional regulator (Pseudomonas simiae WCS417)
MRLTTKGRYAVTAMLDLALHAQTGPVSLADISERQGISLSYLEQLFAKLRRSNLVSSVRG
PGGGYQLSRDMQGIQVAQVIDAVNESVDATKCQGLGDCHAGDTCLTHHLWCDLSLQIHEF
LSGISLADLVTRREVQEVAQRQDQRRCNTKAPRLDKIEASAVE