Protein Info for GFF4534 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 398 PF04052: TolB_N" amino acids 1 to 99 (99 residues), 84.2 bits, see alignment E=1.6e-27 TIGR02800: Tol-Pal system beta propeller repeat protein TolB" amino acids 2 to 394 (393 residues), 473.3 bits, see alignment E=3.6e-146 PF07676: PD40" amino acids 162 to 194 (33 residues), 17.6 bits, see alignment 7.6e-07 amino acids 204 to 238 (35 residues), 23.1 bits, see alignment 1.5e-08 amino acids 248 to 283 (36 residues), 47.5 bits, see alignment 3.1e-16 amino acids 292 to 326 (35 residues), 32.3 bits, see alignment 1.8e-11

Best Hits

Swiss-Prot: 71% identical to TOLB_RHOFT: Tol-Pal system protein TolB (tolB) from Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118)

KEGG orthology group: K03641, TolB protein (inferred from 71% identity to rfr:Rfer_2092)

Predicted SEED Role

"tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins" in subsystem Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (398 amino acids)

>GFF4534 tolB protein precursor, periplasmic protein involved in the tonb-independent uptake of group A colicins (Hydrogenophaga sp. GW460-11-11-14-LB1)
VEVAGVGLTQFPFSVVGFRGNDAASENIAAIVRADLERSGQFRFVDPISGGLDETSRPDL
GPWRERGSDSLLTGSVSRLADGRFDVRFRLWDVVRGQDLGGLSYPVGAQDLRLAAHRIAD
HVFEKITGVKGVFSTRIAYVTKAGQRYNLWVADADGENARAALTSPEPIISPSWAPGGGQ
LAYVSFEARKPVIYAHDVATGKRRLLANFKGSNSAPSWSPDGRSVVATLSLSGNAQIYTM
DANGGEPRRLSQSASIDTEPVFSPDGKSIYFVSDRGGSPQVYRMSAQGGNAQRLTFTGNY
NISPAPSPDGRWLAFISRINGAFRLHVMDLGSGTVTALSESSGDESPSFAANSRMIIYAT
RDRGQEALMTTTVDGRIKTRLAGAQGDIREPEWGPFLK