Protein Info for GFF4530 in Variovorax sp. SCN45

Annotation: MBL-fold metallo-hydrolase superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 PF00293: NUDIX" amino acids 18 to 96 (79 residues), 23.3 bits, see alignment E=8.3e-09 PF00753: Lactamase_B" amino acids 303 to 468 (166 residues), 63 bits, see alignment E=5.9e-21 PF17778: BLACT_WH" amino acids 520 to 548 (29 residues), 23.3 bits, see alignment (E = 7.5e-09)

Best Hits

KEGG orthology group: None (inferred from 89% identity to vpe:Varpa_0916)

Predicted SEED Role

"Metallo-beta-lactamase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (558 amino acids)

>GFF4530 MBL-fold metallo-hydrolase superfamily (Variovorax sp. SCN45)
MVRSSQQIHPAREPAPVRAAATVLLLRDTAAGIEVLMTRRSATASFAPGAYVFPGGHIDA
ADEAAKRIATRRPTQSRVQRTQAIAAIREAFEELGILLAHHADGRPVSAADIAAMDRADT
AGTAFADQCAARGLVLDSDRVFTFAHWITDRDLPKRFDVPFLVARMPEGQTPTADESEQF
EPCWVRPADALARHEAGSFFMIFPTVRTLQRLAAYASVDAVLAACAPLGAGEAPLWTSCP
RAGLLKGEDARYMEHESPFGELALVCPDGQIAHALDWQSEHPVALLKNVMRLTAPNPSAM
TGPGTNSYIVGDAATGYIVVDPGPNDFDHIGRLWRATHGDIRMIVCTHSHADHSPGAAPL
QALCKDKRPPILGLASQPTARATARFTPERELADGERLVLSGTTPEGTAISHTLRVIHTP
GHAANHLCLLLEEDGLLLSGDHILNGSTTVVDPPDGDMTAYLDSLDKLDAACEAGGVEFI
LPAHGYVIGFARTAIAMLKAHRLKREAKIAAAMRKLPDGTPEQWLPIAYDDVPERMWPVA
ARSLAAHVARIRQLAEAR