Protein Info for GFF4529 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Citrate lyase gamma chain, acyl carrier protein (EC 4.1.3.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01608: citrate lyase acyl carrier protein
  • amino acids 1 to 94 (94 residues), 99.2 bits, E=8.5e-33
• PF06857: ACP
  • amino acids 7 to 86 (80 residues), 99.9 bits, E=4e-33

Best Hits

Swiss-Prot: 100% identical to CITD1_SALTI: Citrate lyase acyl carrier protein 1 (citD1) from Salmonella typhi

KEGG orthology group: K01646, citrate lyase subunit gamma [EC: 4.1.3.6] (inferred from 98% identity to spt:SPA2111)

MetaCyc: 91% identical to citrate lyase acyl carrier protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Citrate lyase gamma chain, acyl carrier protein (EC 4.1.3.6)" in subsystem TCA Cycle (EC 4.1.3.6)

MetaCyc Pathways

• citrate degradation (2/2 steps found)

KEGG Metabolic Maps

• Citrate cycle (TCA cycle)

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.6

Use Curated BLAST to search for 4.1.3.6

Protein Sequence (98 amino acids)

>GFF4529 Citrate lyase gamma chain, acyl carrier protein (EC 4.1.3.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MKINQLAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGEAIRATILEVLSRYDVRG
VQLNVDDKGALDCILRARLETLLARASGIAALPWEDRQ