Protein Info for GFF4528 in Variovorax sp. SCN45

Annotation: Permease of the drug/metabolite transporter (DMT) superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 48 to 67 (20 residues), see Phobius details amino acids 80 to 101 (22 residues), see Phobius details amino acids 107 to 127 (21 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 195 to 215 (21 residues), see Phobius details amino acids 227 to 250 (24 residues), see Phobius details amino acids 262 to 278 (17 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details PF00892: EamA" amino acids 23 to 153 (131 residues), 73.2 bits, see alignment E=1.3e-24 amino acids 167 to 300 (134 residues), 51 bits, see alignment E=9.5e-18

Best Hits

KEGG orthology group: None (inferred from 86% identity to vpe:Varpa_0919)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>GFF4528 Permease of the drug/metabolite transporter (DMT) superfamily (Variovorax sp. SCN45)
MQEASTPSSAGQPAINPAFEWALLAVLATCWGASYTFIKIGVATIPPVTLIAARTLIAGA
LLLAVLRMRGVRLPKEPAMWGRFAVQACLNSVLPFTLIAWAERSVDAGLATILNSTSPIF
IFLLGLGMGSAGRPTLQRFFGVGAGLAGICLIVGLEALNGLGHSLLAQLALVAAAVCYGC
AAMFGRVFKGLDPMVPAAGSMLSGTAMLLPASLFIDRPWTLAPSAASVGAVLALAVLSTA
LAFTIYFRLIRTLGPMSTSAQAYLRVPIGVAIGVLFLGETLAPTAWIGLGCVVAGVVAMT
MPEAKLLRRGLHFLRGL