Protein Info for GFF4528 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Citrate lyase beta chain (EC 4.1.3.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 signal peptide" amino acids 16 to 32 (17 residues), see Phobius details amino acids 34 to 34 (1 residues), see Phobius details transmembrane" amino acids 33 to 33 (1 residues), see Phobius details TIGR01588: citrate (pro-3S)-lyase, beta subunit" amino acids 12 to 299 (288 residues), 444.6 bits, see alignment E=6.3e-138 PF03328: HpcH_HpaI" amino acids 15 to 234 (220 residues), 293.6 bits, see alignment E=7.6e-92 PF15617: C-C_Bond_Lyase" amino acids 210 to 299 (90 residues), 29.4 bits, see alignment E=4.9e-11

Best Hits

Swiss-Prot: 95% identical to CITE_ECOLI: Citrate lyase subunit beta (citE) from Escherichia coli (strain K12)

KEGG orthology group: K01644, citrate lyase subunit beta / citryl-CoA lyase [EC: 4.1.3.34 4.1.3.6] (inferred from 99% identity to sei:SPC_0635)

MetaCyc: 95% identical to citrate lyase beta subunit (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Citrate lyase beta chain (EC 4.1.3.6)" (EC 4.1.3.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.3.34, 4.1.3.6

Use Curated BLAST to search for 4.1.3.34 or 4.1.3.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>GFF4528 Citrate lyase beta chain (EC 4.1.3.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MISASLQQRKTRTRRSMLFVPGANAAMVSNSFIYPADALMFDLEDSVALREKDAARRLVY
HALQHPLYRDVETIVRVNALDSEWGVNDLEAVVRGGADVVRLPKTDTAQDVIDIENEILR
IENACGREPGSTGLLAAVESPLGITRAVEIAHASERLIGIALGAEDYVRNLRTERSPEGT
ELLFARCAILQAARSAGIQAFDTVYSDANNEAGFLQEAAHIKQLGFDGKSLINPRQIELL
HNLYAPTRKEVAHARLVVEAAEAAAREGLGVVSLNGKMVDSPVIERARLVLSRAELSGIR
EE