Protein Info for GFF4522 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: ATPase component BioM of energizing module of biotin ECF transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 514 PF05872: HerA_C" amino acids 6 to 513 (508 residues), 744.5 bits, see alignment E=8.4e-228 PF01935: DUF87" amino acids 20 to 197 (178 residues), 26.9 bits, see alignment E=7.5e-10

Best Hits

Swiss-Prot: 67% identical to YJGR_ECOLI: Uncharacterized protein YjgR (yjgR) from Escherichia coli (strain K12)

KEGG orthology group: K06915, (no description) (inferred from 77% identity to dia:Dtpsy_1702)

Predicted SEED Role

"ATPase component BioM of energizing module of biotin ECF transporter" in subsystem Biotin biosynthesis or ECF class transporters

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (514 amino acids)

>GFF4522 ATPase component BioM of energizing module of biotin ECF transporter (Hydrogenophaga sp. GW460-11-11-14-LB1)
MAEPMLIAQNASTTCQLLPGLANRHGLITGATGTGKTVTLQTLAEQFSNIGVPVFMADVK
GDLSGISQPGSFGEKMSGILKDRGITPPASQACPTTLWDVFGELGHPVRATISDMGPLLL
ARMLNLNDTQAGVLNLVFKIADDNGLLLLDMKDLRAMLQHIGDNAKQFTTEYGNISAASI
GAIQRGLMQVEQQGGDKFFGEPMLDISDFMQTVDGKGVINVLAADKLMNAPRLYATFLLW
MLSELFETLPEIGDPDKPKLVFFFDEAHLLFNEAPKVLIERIELVVRLVRSKGVGVYFVT
QNPLDIPDSVLGQLGNRVQHALRAFTPRDQKAVKSTAQTMRPKAGLDIEAAITELAVGEA
LVSLLDPKGRPSETERVFVVPPGSQLGPITDAQRQQLRQNSLVAGVYEKVVDRESAYEMF
AQHAGQRGAEEPADAPAKTPRIPGADKQQAPADSGGFGNLVNEALFGRTGPRGGQYDGLV
QTMAKTAARSVASGLGRQLVRGMLGGLLGGSRKR