Protein Info for PS417_23140 in Pseudomonas simiae WCS417

Annotation: histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR00442: histidine--tRNA ligase" amino acids 6 to 414 (409 residues), 510.3 bits, see alignment E=1.9e-157 PF13393: tRNA-synt_His" amino acids 10 to 313 (304 residues), 139.6 bits, see alignment E=2.1e-44 PF00587: tRNA-synt_2b" amino acids 68 to 317 (250 residues), 95 bits, see alignment E=8.8e-31 PF03129: HGTP_anticodon" amino acids 333 to 421 (89 residues), 28.4 bits, see alignment E=2.2e-10

Best Hits

Swiss-Prot: 97% identical to SYH_PSEFS: Histidine--tRNA ligase (hisS) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K01892, histidyl-tRNA synthetase [EC: 6.1.1.21] (inferred from 97% identity to pfs:PFLU5056)

MetaCyc: 62% identical to histidine--tRNA ligase (Escherichia coli K-12 substr. MG1655)
Histidine--tRNA ligase. [EC: 6.1.1.21]

Predicted SEED Role

"Histidyl-tRNA synthetase (EC 6.1.1.21)" (EC 6.1.1.21)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.21

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U695 at UniProt or InterPro

Protein Sequence (429 amino acids)

>PS417_23140 histidinol dehydrogenase (Pseudomonas simiae WCS417)
MSKSLQAIRGMNDILPEQTPLWRYFEGTVARLLDNYGYKQIRMPIVEFTELFKRSIGEVT
DIVEKEMYTFEDRNGDSLTLRPEGTAACVRAVLEHGLTGAGQPQKLWYIGPMFRHERPQK
GRYRQFHQIGLEVFNIDGPDIDAELIVLTWRLWGLLGIRDAVKLELNSLGTSESRGRYKV
ALVEYLSAHLDKLDEDSQRRLKTNPLRVLDTKNADTQAVLVNAPKMADYLDDESRIHFEG
LKARLEAAGIPFEINTKLVRGLDYYSKTVFEWVTDKLGAQGTVCAGGRYDGLVEQMGGKP
TTGVGFAMGIERLILLLETLEKVPEEISRQVDVYLCAFGEAAELAALALSEKVRDQLPNL
RLQVNAGAGSFKSQFKKADKSGALYALILGDDELAQQVIGFKPLRGQGEQQNIAFDALAA
HLATCVVQG