Protein Info for GFF4518 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 80 to 97 (18 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 130 to 154 (25 residues), see Phobius details amino acids 166 to 184 (19 residues), see Phobius details amino acids 195 to 213 (19 residues), see Phobius details amino acids 225 to 249 (25 residues), see Phobius details PF04976: DmsC" amino acids 4 to 175 (172 residues), 67.7 bits, see alignment E=5.9e-23

Best Hits

KEGG orthology group: None (inferred from 96% identity to ses:SARI_02323)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>GFF4518 Anaerobic dimethyl sulfoxide reductase chain C (EC 1.8.5.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MEKYELPLVFFTVLSQMSVGMALVLTWRTLRGEVEGQRFYWLATGLVLALASIAAILHLA
HPDRAYDALINLRHAWLSREILGATLFGAAVGVTFLAKGHKAMALIASVFGVLLVAVQGM
TYAAPAMVAIANGFTMLLFFITVWVMGCAAIPLLKLRPAVPALRQGIVVCIAVLIAAPLV
WLSGGTVMQMTARSWLASPFYLASLVCLALAFVASRHGDSRPKRLFVLLFVGVFLSRLVF
FGDTVSTIVNIGHLY