Protein Info for GFF4517 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12837: Fer4_6
  • amino acids 7 to 23 (17 residues), 24.1 bits, see alignment (E = 1.2e-08)
  • amino acids 81 to 104 (24 residues), 31.2 bits, see alignment (E = 6.3e-11)
• PF12800: Fer4_4
  • amino acids 10 to 23 (14 residues), 16.4 bits, see alignment (E = 4.3e-06)
  • amino acids 56 to 71 (16 residues), 10.7 bits, see alignment (E = 0.0003)
  • amino acids 86 to 102 (17 residues), 21 bits, see alignment (E = 1.4e-07)
• PF13247: Fer4_11
  • amino acids 52 to 142 (91 residues), 93.6 bits, E=3.4e-30
• PF13237: Fer4_10
  • amino acids 56 to 100 (45 residues), 27.3 bits, E=1.3e-09
  • amino acids 82 to 136 (55 residues), 28 bits, E=7.4e-10
• PF12838: Fer4_7
  • amino acids 57 to 103 (47 residues), 35.4 bits, E=5.4e-12
• PF00037: Fer4
  • amino acids 82 to 104 (23 residues), 30.4 bits, see alignment (E = 1.1e-10)
• PF12798: Fer4_3
  • amino acids 89 to 103 (15 residues), 15.2 bits, see alignment (E = 1.5e-05)
  • amino acids 116 to 139 (24 residues), 14.8 bits, see alignment (E = 2e-05)

Best Hits

KEGG orthology group: None (inferred from 99% identity to sew:SeSA_A0770)

Predicted SEED Role

"Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3)" (EC 1.8.5.3)

MetaCyc Pathways

• NADH to dimethyl sulfoxide electron transfer (2/2 steps found)
• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• hydrogen to dimethyl sulfoxide electron transfer (1/2 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.8.5.3

Use Curated BLAST to search for 1.8.5.3

Protein Sequence (185 amino acids)

>GFF4517 Anaerobic dimethyl sulfoxide reductase chain B (EC 1.8.5.3) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MRRAFLVNSDKCIGCRGCAMACKSFNQLEPDRFWRYVYPLDKDIYPHEERAFYSLACNHC
EHPACVAACPVEAYTKREDGVVVHNPERCIGCKNCIRNCPYGAPRFNEETRKAEKCSMCY
ERLDIGMNPACVNACPVGALSIIDLDADPVPDNAVQYPPGFPHMPQLNPGTRFILARQPK
QPEDK