Protein Info for PS417_23095 in Pseudomonas simiae WCS417

Annotation: exodeoxyribonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF13742: tRNA_anti_2" amino acids 16 to 108 (93 residues), 103 bits, see alignment E=1.3e-33 TIGR00237: exodeoxyribonuclease VII, large subunit" amino acids 17 to 360 (344 residues), 428.8 bits, see alignment E=1.1e-132 PF01336: tRNA_anti-codon" amino acids 36 to 110 (75 residues), 50.2 bits, see alignment E=3.1e-17 PF02601: Exonuc_VII_L" amino acids 132 to 443 (312 residues), 372.8 bits, see alignment E=2.6e-115

Best Hits

Swiss-Prot: 99% identical to EX7L_PSEFS: Exodeoxyribonuclease 7 large subunit (xseA) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K03601, exodeoxyribonuclease VII large subunit [EC: 3.1.11.6] (inferred from 99% identity to pfs:PFLU5048)

MetaCyc: 44% identical to exodeoxyribonuclease VII subunit XseA (Escherichia coli K-12 substr. MG1655)
Exodeoxyribonuclease VII. [EC: 3.1.11.6]

Predicted SEED Role

"Exodeoxyribonuclease VII large subunit (EC 3.1.11.6)" in subsystem DNA repair, bacterial (EC 3.1.11.6)

Isozymes

Compare fitness of predicted isozymes for: 3.1.11.6

Use Curated BLAST to search for 3.1.11.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See U1SYJ0 at UniProt or InterPro

Protein Sequence (459 amino acids)

>PS417_23095 exodeoxyribonuclease (Pseudomonas simiae WCS417)
MIKDPFARLGLDREVLTVSQLNGRARVLLEDVFTNIWVEGEISNLARPASGHVYFTLKDS
GAQVRCALFRNNAARVRQALKDGLAVKVRGKVSLFEGRGDYQLILDTVEPAGDGALRLAF
DALKEKLSAEGLFSAERKVPLPAHPRRIGIISSPTGAVIRDIISVFRRRAPNIELTLIPT
AVQGREAIPQIVRALKLADARGFDALILARGGGSLEDLWCFNEEAVARAVDACVTPIVSA
VGHETDVSISDFVADVRAPTPSAAAELLAPDASHLVRQVENLHRRLVMLMRNRLSHDRLR
LEGMARRLRHPGERLRQQAQRLDDLDMRLRRAFERSLNTRRERLIRLETRLAGQHPGRQL
ALLRQRLDSLAERLPRAMREGLKSRRLQLQSQMQTLHVVSPLATLGRGYSILLDERGQAI
RNAAQTHTGQRLTARLGEGQLQVRVEDNHLTPVTLSLLD