Protein Info for GFF4510 in Sphingobium sp. HT1-2

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF00072: Response_reg" amino acids 11 to 121 (111 residues), 77.5 bits, see alignment E=1.4e-25 PF00512: HisKA" amino acids 156 to 220 (65 residues), 51.9 bits, see alignment E=9.4e-18 PF02518: HATPase_c" amino acids 267 to 378 (112 residues), 92.8 bits, see alignment E=2.9e-30

Best Hits

KEGG orthology group: None (inferred from 66% identity to swi:Swit_5356)

Predicted SEED Role

"Chemotaxis protein methyltransferase CheR (EC 2.1.1.80)" in subsystem Bacterial Chemotaxis (EC 2.1.1.80)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.80

Use Curated BLAST to search for 2.1.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>GFF4510 hypothetical protein (Sphingobium sp. HT1-2)
MTSTSDPINFLLVDDLEENLLALEALLKRDGLAFLKARSGEEALELLLTHDIALALLDVQ
MPGMDGFELAGFMRGNERTRHIPIIFLTAGSADLQRRFRGYDAGAVDFIQKPIEADILRS
KTNVFYELYRQRSEIVAQRDALASMADALQAADRRKNEFLAILGHELRNPIAAIGAGLHL
LERRAGTGVEGEIREGMNRHIRHVSRLVDDLLDIARIDQGKISLKLERISLQDVLAFAIE
ASQPLIESGGHRLVRDLPDATIWLEADFSRLAQIASNLLNNAAKYTPPGGEIRLTARRKG
PWAEVEVADNGIGIPPEMQEKIFDLFAQVSRPGSDRLDGLGIGLALVKQLVGLHGGTLHL
ERSEMGKGSVFLVRLPCEP