Protein Info for GFF4507 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Glycerol dehydrogenase (EC 1.1.1.6)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 transmembrane" amino acids 112 to 128 (17 residues), see Phobius details PF00465: Fe-ADH" amino acids 12 to 149 (138 residues), 80.1 bits, see alignment E=1.5e-26 PF13685: Fe-ADH_2" amino acids 18 to 163 (146 residues), 49.2 bits, see alignment E=6e-17

Best Hits

Swiss-Prot: 82% identical to HCXA_ECOLI: Hydroxycarboxylate dehydrogenase A (hcxA) from Escherichia coli (strain K12)

KEGG orthology group: K08317, uncharacterized oxidoreductase [EC: 1.1.-.-] (inferred from 99% identity to sea:SeAg_B0641)

Predicted SEED Role

"Glycerol dehydrogenase (EC 1.1.1.6)" in subsystem Respiratory dehydrogenases 1 (EC 1.1.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.-.-, 1.1.1.6

Use Curated BLAST to search for 1.1.-.- or 1.1.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (362 amino acids)

>GFF4507 Glycerol dehydrogenase (EC 1.1.1.6) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNHTEIRVVTGPANYFSHAGSLERLTDFFTPEQLSHAVWVYGERAIAAARPYLPEAFERA
GAKHLPFTGHCSERHVAQLAHACNDDRQVVIGVGGGALLDTAKALARRLALPFVAIPTIA
ATCAAWTPLSVWYNDAGQALQFEIFDDANFLVLVEPRIILQAPDDYLLAGIGDTLAKWYE
AVVLAPQPETLPLTVRLGINSACAIRDLLLDSSEQALADKQQRRLTQAFCDVVDAIIAGG
GMVGGLGERYTRVAAAHAVHNGLTVLPQTEKFLHGTKVAYGILVQSALLGQDDVLAQLIT
AYRRFHLPARLSELDVDIHNTAEIDRVIAHTLRPVESIHYLPVTLTPDTLRAAFEKVEFF
RI