Protein Info for GFF4505 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Carbon starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 701 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 32 to 52 (21 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 117 to 138 (22 residues), see Phobius details amino acids 159 to 183 (25 residues), see Phobius details amino acids 191 to 211 (21 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 325 to 345 (21 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 402 to 423 (22 residues), see Phobius details amino acids 442 to 459 (18 residues), see Phobius details amino acids 470 to 490 (21 residues), see Phobius details amino acids 515 to 534 (20 residues), see Phobius details amino acids 548 to 571 (24 residues), see Phobius details amino acids 578 to 598 (21 residues), see Phobius details amino acids 647 to 668 (22 residues), see Phobius details PF02554: CstA" amino acids 33 to 596 (564 residues), 852.9 bits, see alignment E=6.2e-261

Best Hits

Swiss-Prot: 97% identical to CSTA_ECOLI: Peptide transporter CstA (cstA) from Escherichia coli (strain K12)

KEGG orthology group: K06200, carbon starvation protein (inferred from 97% identity to eco:b0598)

MetaCyc: 97% identical to pyruvate transporter CstA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (701 amino acids)

>GFF4505 Carbon starvation protein A (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MNKSGKYLVWTALSVLGAFALGYIALNRGEQINALWIVVASVCVYLIAYRFYGLYIAKKV
LAVDPTRMTPAVRHNDGLDYVPTDKKVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGMIWL
LAGVVLAGAVQDFMVLFVSTRRDGRSLGELVKEEMGATAGVIALVACFMIMVIILAVLAM
IVVKALTHSPWGTYTVAFTIPLAIFMGIYLRYLRPGRIGEVSVIGLVFLIFAIISGGWVA
ASPTWAPYFDFTGVQLTWMLVGYGFVAAVLPVWLLLAPRDYLSTFLKIGTIVGLAVGILI
MRPTLTMPALTKFVDGTGPVWTGDLFPFLFITIACGAVSGFHALISSGTTPKMLANEGQA
CFIGYGGMLMESFVAIMALVSACIIDPGVYFAMNSPMAVLAPAGTADVVASAAQVVSSWG
FAITPDTLHQIANEVGEQSIISRAGGAPTLAVGMAYILHGALGGMMDVAFWYHFAILFEA
LFILTAVDAGTRAARFMLQDLLGVVSPGLKRTDSLPANLLATALCVLAWGYFLHQGVVDP
LGGINTLWPLFGIANQMLAGMALMLCAVVLFKMKRQRYAWVALVPTAWLLICTLTAGWQK
AFSPDAKIGFLAIANKFQAMIDSGNIPPQYTESQLAQLVFNNRLDAGLTIFFMVVVVVLA
VFSIKTALAALKIDKPTANETPYEPMPENVDEIVTQAKGAH