Protein Info for GFF4502 in Xanthobacter sp. DMC5

Annotation: Flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 240 TIGR03506: flagellar hook-basal body protein" amino acids 4 to 119 (116 residues), 129 bits, see alignment E=3.5e-41 TIGR02490: flagellar basal-body rod protein FlgF" amino acids 5 to 217 (213 residues), 200 bits, see alignment E=3.8e-63 PF00460: Flg_bb_rod" amino acids 5 to 35 (31 residues), 35.6 bits, see alignment 1.1e-12 PF22692: LlgE_F_G_D1" amino acids 80 to 145 (66 residues), 43.9 bits, see alignment E=3.3e-15 PF06429: Flg_bbr_C" amino acids 191 to 234 (44 residues), 52.3 bits, see alignment 5e-18

Best Hits

KEGG orthology group: K02391, flagellar basal-body rod protein FlgF (inferred from 54% identity to azc:AZC_0645)

Predicted SEED Role

"Flagellar basal-body rod protein FlgF" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (240 amino acids)

>GFF4502 Flagellar basal-body rod protein FlgG (Xanthobacter sp. DMC5)
MGSGLYVSLSAQLAADKRLTTIANNVANLNTAGYRAEEVRFEEMVSKAGGQDVSFTSTGE
TYTSRKSGPINPTGNPLDIAVEGKGWFAVRDGATTAYTRDGRMNMSPEGELRTLSGRPIL
DASGAPVVIDPTGGTVRIGTDGSISQNRRAIGRIGLFLIPEDAKLTRRDGALVVPDKPAA
LVQNYNRNVVRQGFVEGANVDAITEMTRLIALQRAFEMAASAVSQTEDSTSQTIRELGPG