Protein Info for GFF4501 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: SOS-response repressor and protease LexA (EC 3.4.21.88)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR00498: repressor LexA" amino acids 10 to 224 (215 residues), 228.5 bits, see alignment E=3.1e-72 PF01726: LexA_DNA_bind" amino acids 10 to 72 (63 residues), 88.4 bits, see alignment E=2.1e-29 PF00717: Peptidase_S24" amino acids 104 to 218 (115 residues), 112 bits, see alignment E=1.3e-36

Best Hits

Swiss-Prot: 83% identical to LEXA_VARPS: LexA repressor (lexA) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01356, repressor LexA [EC: 3.4.21.88] (inferred from 83% identity to vap:Vapar_2636)

Predicted SEED Role

"SOS-response repressor and protease LexA (EC 3.4.21.88)" in subsystem DNA repair, bacterial (EC 3.4.21.88)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.21.88

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>GFF4501 SOS-response repressor and protease LexA (EC 3.4.21.88) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MLDLPHTAPKLTARQQQILELIQTAIARTGAPPTRAEIASELGFKSANAAEEHLQALARK
GVIELVSGTSRGIRLRSEDLQSINNSRARQLTLPIPGLAQLVLPLIGRVAAGSPILAQEH
VDQTYQVERSLFQRTPDYLLKVRGMSMRDIGIMDGDLLAVQATKEAKNGQIVVARLGDDV
TVKRFMRRQHLIELHAENPDYKTIVVEPGEPFEIEGLAVGLIRNSFQL