Protein Info for PS417_02295 in Pseudomonas simiae WCS417

Annotation: polymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 618 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 60 (20 residues), see Phobius details amino acids 72 to 91 (20 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 128 to 148 (21 residues), see Phobius details amino acids 168 to 185 (18 residues), see Phobius details amino acids 192 to 209 (18 residues), see Phobius details amino acids 215 to 231 (17 residues), see Phobius details amino acids 237 to 255 (19 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 342 to 359 (18 residues), see Phobius details amino acids 371 to 388 (18 residues), see Phobius details PF04932: Wzy_C" amino acids 200 to 324 (125 residues), 48 bits, see alignment E=1.2e-16 PF06293: Kdo" amino acids 500 to 594 (95 residues), 24.6 bits, see alignment E=1.6e-09

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfs:PFLU0480)

Predicted SEED Role

"Oligosaccharide repeat unit polymerase Wzy; O-antigen ligase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UBV0 at UniProt or InterPro

Protein Sequence (618 amino acids)

>PS417_02295 polymerase (Pseudomonas simiae WCS417)
MHSKRLIYGSNRVFDFLVLWILPIGLLLLLSSLFFVSNRNVLHRIVYILFSVPTLFMLCM
RPRELKELLREPLALAFLAFSAWALASLMWSPEPTTDTDLFKRPLNTFMLFGGCGLLLHY
RNELFKPIFFSAAVIALVVSLCNLVAFVKGFEPGMRMIGGRGALDNPLLSSHLFGFFCVY
WLYVCMTTQRLNVLWFSAPALAVMLAAVLATGSRTPLVALTLTILWMTFVSRNRRSALLI
AGMILGGVGLLLLYPEQITTRGSSFRFELWGMSLQRIAEHPWIGHSYDSELYLTLSDGYE
LREPHSFALGVLYYVGIIGFIPWIFMLGWGLYKGLKERAQPLFILASSLLAYGIGAGLTE
GGGILSRPKEHWFLLWIPLAIITGLSMAQRRRSLLRIPVQNLQPEGFNQLCADAHVIEAD
GLGPKVLRLADGRFLKVFRPRRWYTSGSFNPYSERFASNAEQLRTLGIPTPQILGLYRLP
DASSAVSYSPLPGLTLRQALQSLDNSLRESLIERFGQFMAQLHERGVYFRSLHLGNVLLM
DDGEFGLIDIADLRIYPSPLRNALRQRNLRHMQRYPQDRAWLFETHFEQLAKGYASVASQ
GATAKIREHVLALSRPAA