Protein Info for GFF4495 in Xanthobacter sp. DMC5

Annotation: Flagellar biosynthetic protein FlhB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 34 to 56 (23 residues), see Phobius details amino acids 86 to 88 (3 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 151 to 168 (18 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details PF01312: Bac_export_2" amino acids 8 to 349 (342 residues), 378.4 bits, see alignment E=1.7e-117 TIGR00328: flagellar biosynthetic protein FlhB" amino acids 8 to 351 (344 residues), 372.2 bits, see alignment E=1.3e-115

Best Hits

Swiss-Prot: 50% identical to FLHB_RHIME: Flagellar biosynthetic protein FlhB (flhB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02401, flagellar biosynthetic protein FlhB (inferred from 63% identity to azc:AZC_0639)

Predicted SEED Role

"Flagellar biosynthesis protein FlhB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (358 amino acids)

>GFF4495 Flagellar biosynthetic protein FlhB (Xanthobacter sp. DMC5)
MSEEQDKESKTEEASEKKISDAVEKGNVPFSREAALFASLLGILAILAFFVTAPVRLLTA
DLSRLIDDPAGFPISTGNDAVSILWGALAGAGRFLMPMVIVLMLAGLVASGFQNVPSLVA
ERIRPQWSRVSPSAGFKRIFGTQGHIEFGKALFKLFAIGIVAALVLYAQEHEVVNAMFTD
PLRLPSVLLALAMRLVATVCVVTIGLVAADIVWSRVSWKTNLRMTKQEVKDEFKQAEGDP
MVKARIRAVARERARQRMMNAVPKATVVIANPTHYAVALQYDRQTGGAPLVVAKGVDLIA
LKIREIAERHGVPVIEDRPLARALFAAVEVDQWIPQDFYRPVAKILHYIYARPGHGAK