Protein Info for GFF4495 in Variovorax sp. SCN45

Annotation: Hydrolase, alpha/beta fold family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00561: Abhydrolase_1" amino acids 22 to 256 (235 residues), 112.8 bits, see alignment E=6.8e-36 PF12697: Abhydrolase_6" amino acids 23 to 264 (242 residues), 85.6 bits, see alignment E=2.4e-27 PF12146: Hydrolase_4" amino acids 23 to 123 (101 residues), 46.3 bits, see alignment E=1e-15 amino acids 205 to 257 (53 residues), 29.7 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 68% identical to ESTE_PSEFL: Arylesterase from Pseudomonas fluorescens

KEGG orthology group: None (inferred from 94% identity to vap:Vapar_5467)

Predicted SEED Role

"Alpha/beta hydrolase fold (EC 3.8.1.5)" (EC 3.8.1.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.8.1.5

Use Curated BLAST to search for 3.8.1.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (273 amino acids)

>GFF4495 Hydrolase, alpha/beta fold family (Variovorax sp. SCN45)
MTTLTLRDGTELYYKDWGSGQPILFSHGWPLSADMWDAQMLFFAERGYRTIAFDRRGFGR
SSQPWTGYDYDTFADDISELIEKLDLKDVILAGFSMGGGDVTRYIARKGSARVARLALIS
AVTPLFMKTADHPVGPDASLFAGIRAGLAADRPQFLDDFSTVFYGTNRPGAKVSQGVFKQ
TLQIALQASIKATIDCVTAFSETDFRPDMAKIDVPTLVIHGDDDQVVPFEATGKLAAEMI
KGSQLKVYAGAPHATCNTHADQVNADLLAFIQA