Protein Info for GFF4495 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: ABC-type Fe3+-siderophore transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 PF00005: ABC_tran" amino acids 24 to 172 (149 residues), 117 bits, see alignment E=1.5e-37

Best Hits

Swiss-Prot: 92% identical to FEPC_ECOLI: Ferric enterobactin transport ATP-binding protein FepC (fepC) from Escherichia coli (strain K12)

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 100% identity to seh:SeHA_C0702)

MetaCyc: 92% identical to ferric enterobactin ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34 or 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (264 amino acids)

>GFF4495 ABC-type Fe3+-siderophore transport system, ATPase component (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTESVARLRGDQLTLGYGSYTVAKNLNVSIPDGHFTAIIGPNGCGKSTLLRTLSRLMTPV
DGHVWLDGEQIQRYASKEVARRIGLLAQNATTPGDITVQELVARGRYPHQPLFTRWRKED
ADAVASAMRATGITSLAAQSVDTLSGGQRQRAWIAMVLAQETSIMLLDEPTTWLDISHQI
DLLELLSDLNREKGYTLAAVLHDLNQACRYATHLIALREGNIVAQGAPKEIVTAELIEKI
YGLRCMIIDDPVAGTPLVVPLGRR