Protein Info for GFF4490 in Xanthobacter sp. DMC5

Annotation: Flagellar basal-body rod protein FlgG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details TIGR03506: flagellar hook-basal body protein" amino acids 3 to 137 (135 residues), 159.4 bits, see alignment E=2e-50 amino acids 146 to 243 (98 residues), 111.6 bits, see alignment E=7e-36 TIGR02488: flagellar basal-body rod protein FlgG" amino acids 3 to 259 (257 residues), 353.6 bits, see alignment E=6.7e-110 PF00460: Flg_bb_rod" amino acids 5 to 34 (30 residues), 44.3 bits, see alignment 2e-15 PF22692: LlgE_F_G_D1" amino acids 96 to 159 (64 residues), 81.3 bits, see alignment E=6.6e-27 PF06429: Flg_bbr_C" amino acids 215 to 256 (42 residues), 77.4 bits, see alignment 6.9e-26

Best Hits

Swiss-Prot: 65% identical to FLGG_RHIME: Flagellar basal-body rod protein FlgG (flgG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02392, flagellar basal-body rod protein FlgG (inferred from 74% identity to azc:AZC_0634)

Predicted SEED Role

"Flagellar basal-body rod protein FlgG" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>GFF4490 Flagellar basal-body rod protein FlgG (Xanthobacter sp. DMC5)
MRALAIAATGMSAQQTNVEVIANNIANINTTGFKRARAEFTDLLYQAERAQGVPNQDGAE
PVPEGALVGLGVRTIGIRNLHLQGPLAQTGNPLDLALNGRGWFQITSPSGDTLYTRAGSF
NKGPTGQLVTADGYALNPALTLPQDASSIVINESGQVYAQIANQSAPTLVGQLTLATFAN
DSGLEPLGDNLYRETSASGQPVTGVAGTTGFGAVVQGYLEGSNVDPIKEITQLIQAQRAY
EMNSKVIQAADDMAGVVSKGIR