Protein Info for GFF4489 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Benzoate transport, inner-membrane translocator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 110 to 128 (19 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 265 (30 residues), see Phobius details amino acids 272 to 292 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 23 to 289 (267 residues), 129.9 bits, see alignment E=5e-42

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 84% identity to pol:Bpro_2986)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (300 amino acids)

>GFF4489 Benzoate transport, inner-membrane translocator (Hydrogenophaga sp. GW460-11-11-14-LB1)
LLALFVRFSPPRFMDFANFLIQLLNSLQYGLLLFMLAAGLTLIFGIMGVVNLAHGSFYML
GAYLAWFLASQLDSLVLAIVLGTVIAVALGWLLEWLLFRHFYHRDHLDQVLLTFGLIYIF
EEVRSILWGDDVHSVQVPELLNWSIPLTDNLSYPVYRLVMSGVCVALALGLYLLISRTRL
GMKIRAGAFNREMTESLGINIRLIHGVVFALGVALAAIAGMIASPVSSVYPGMGSSVLIM
CFVVVVIGGIGSVRGALVAALLVGLVDTFGKVLVPQIAGMAVYMLMAAVLLYKPEGLFKQ