Protein Info for GFF4488 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Benzoate transport, inner-membrane translocator precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 14 to 14 (1 residues), see Phobius details transmembrane" amino acids 15 to 33 (19 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 94 to 116 (23 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 261 to 287 (27 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details PF02653: BPD_transp_2" amino acids 41 to 308 (268 residues), 146.6 bits, see alignment E=4.2e-47

Best Hits

KEGG orthology group: K01998, branched-chain amino acid transport system permease protein (inferred from 72% identity to pna:Pnap_4746)

Predicted SEED Role

"Benzoate transport, inner-membrane translocator precursor" in subsystem Benzoate transport and degradation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>GFF4488 Benzoate transport, inner-membrane translocator precursor (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSSPKAQLEKLPRSMQVILLLGAVALAAFPLMPLTGVDFYLQMLSQMMILAIFAMSLDLL
QGVTGLVSLGHAAYFGLAGYALAFLTPADTPISLWWSLPVSALGAGLAALIIGFFVVRTR
GIYFIMVTMAFAQMVFFLFFDNKALGGSDGIYVNFRPDASLFGWTGIDLENKTTFYYFTL
LLLVLVYAFLRRLLFSPFGRVLAGIRVNEHRMRAVGYGTFGYKLAAFTLAGALAGVAGFL
WAAQTGFVNPELMGFHMSAHAIMMVILGGMGNFAGAIVGAFAFEYVMHFFKDLTKHWQLL
MGSFIVLIVVFAPRGLLGLVAQFSRKRGAP