Protein Info for GFF4485 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Transcriptional activator RamA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 113 PF00165: HTH_AraC" amino acids 15 to 55 (41 residues), 30.9 bits, see alignment E=2.4e-11 amino acids 69 to 106 (38 residues), 30.1 bits, see alignment E=4.3e-11 PF12833: HTH_18" amino acids 28 to 106 (79 residues), 81.4 bits, see alignment E=4.7e-27

Best Hits

Swiss-Prot: 90% identical to RAMA_KLEPN: Transcriptional activator RamA (ramA) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 98% identity to stt:t2287)

Predicted SEED Role

"Transcriptional activator RamA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (113 amino acids)

>GFF4485 Transcriptional activator RamA (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MTISAQVIDTIVEWIDDNLNQPLRIDDIARHAGYSKWHLQRLFMQYKGESLGRYVRERKL
KLAARDLLDTDQKVYDICLKYGFDSQQTFTRIFTRTFNLPPGAYRKEKHGRTH