Protein Info for GFF4484 in Variovorax sp. SCN45

Annotation: ATP-dependent protease subunit HslV (EC 3.4.25.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00227: Proteasome
  • amino acids 7 to 182 (176 residues), 84.2 bits, E=4.8e-28
• TIGR03692: ATP-dependent protease HslVU, peptidase subunit
  • amino acids 10 to 184 (175 residues), 278.4 bits, E=9.3e-88

Best Hits

Swiss-Prot: 98% identical to HSLV_VARPS: ATP-dependent protease subunit HslV (hslV) from Variovorax paradoxus (strain S110)

KEGG orthology group: K01419, ATP-dependent HslUV protease, peptidase subunit HslV [EC: 3.4.25.2] (inferred from 98% identity to vap:Vapar_0908)

MetaCyc: 72% identical to peptidase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent protease HslV (EC 3.4.25.-)" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent (EC 3.4.25.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.25.-

Use Curated BLAST to search for 3.4.25.- or 3.4.25.2

Protein Sequence (184 amino acids)

>GFF4484 ATP-dependent protease subunit HslV (EC 3.4.25.2) (Variovorax sp. SCN45)
MASMEQFHGTTIVSVRRKTPQGDQVAIGGDGQVTLGNIVIKGTARKVRRLYHGKVLAGFA
GATADAFTLFERFEAKLEKHQGHLTRAAVELTKDWRTDRVLRKLEAMLAVADATTSLIIT
GNGDVLEPEDGVIAIGSGGAYAQSAAKALIENTELSAEQIVRKSLSIAGEICIYTNMNHT
VEAL