Protein Info for PS417_22935 in Pseudomonas simiae WCS417

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 55 to 79 (25 residues), see Phobius details amino acids 86 to 105 (20 residues), see Phobius details amino acids 129 to 148 (20 residues), see Phobius details PF01595: CNNM" amino acids 14 to 149 (136 residues), 39.8 bits, see alignment E=6e-14 PF00571: CBS" amino acids 264 to 313 (50 residues), 30.5 bits, see alignment 5.5e-11 PF03471: CorC_HlyC" amino acids 330 to 402 (73 residues), 64.3 bits, see alignment E=1.3e-21

Best Hits

KEGG orthology group: None (inferred from 96% identity to pfs:PFLU5015)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U657 at UniProt or InterPro

Protein Sequence (412 amino acids)

>PS417_22935 hypothetical protein (Pseudomonas simiae WCS417)
MDNLPLEPMLAVIALLVLWAALFTAIEAAQQHLLALRPGTRQGDKAAARLSFPRHSLILC
NSLCRAAVVILCTLLAIYAWAQNGPWLGWMISCAILLILADYLPRALAVRHPQAVLGFGN
TLLGVPLKILYPLAWLLNGISLLLLRPFARKSGVVKKSDEPLPDHDDEPEPESDESRTPG
MPGIHALDNITVNDILVPRSEVDGINLDDSIEEIIEQLRTSQRTRLPVFHSDINQVQAVL
NTRQIQHLLPDASLTKEALLAACHEPYFVPESTPLQLQLLNFHKQQRRLGMVVDEYGEVL
GIVTLEDILEEIVGEFESEQSADNPHIEPQPDGRYIIDGAASIRELNKSLNWHLPSDGPK
TLNGLVTEALETIPDCAVCLKIGRYRLEILETEDNRVSKVLIWHTSRMPVAA