Protein Info for PS417_02285 in Pseudomonas simiae WCS417

Annotation: glycosyl transferase family 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF13439: Glyco_transf_4" amino acids 27 to 177 (151 residues), 40.8 bits, see alignment E=3.6e-14 PF00534: Glycos_transf_1" amino acids 187 to 343 (157 residues), 91.8 bits, see alignment E=5.6e-30 PF13692: Glyco_trans_1_4" amino acids 201 to 337 (137 residues), 82.8 bits, see alignment E=4.4e-27

Best Hits

KEGG orthology group: None (inferred from 100% identity to pfs:PFLU0478)

Predicted SEED Role

"Glycosyl transferase in large core OS assembly cluster"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U602 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PS417_02285 glycosyl transferase family 1 (Pseudomonas simiae WCS417)
MKPRFKVLQLQPDYNVKLNDFADLGEQIVKALPTERFEVTSAFLSGRPQPGQPLSVADHS
KYFEFPEKALKGIRLGAMWEIYKYCREQKFDVVICNRFKSVNMMLSLNRWLKIPLCIGIS
HGFGEYERAYRRRQTRRLVSPAWRFVGVSAAVRDYLVGLNCGFTRENTTFVTNAIDIPQA
EALQLPREQARQALGLPLDARIIGALGRLVPIKGHTHLLQAFARLKDKYPNAQVGIIGSG
RAEADLRADIERLGLTGRAHLLGFREDGLKYVRAFDIWTMPSLLEGLGLALLEGMSGRLP
VIASNGPAMLPLVEGAGGLSHEPGNVEQLTTALDTYLAMSDEQLRAKGEQVFRYLEENHA
LAEFQQKYLNLIETGLKEVGRA