Protein Info for GFF448 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 PF13432: TPR_16" amino acids 17 to 77 (61 residues), 29.7 bits, see alignment E=6.3e-10 amino acids 57 to 110 (54 residues), 35 bits, see alignment 1.5e-11 amino acids 84 to 145 (62 residues), 30.4 bits, see alignment E=3.9e-10 PF14559: TPR_19" amino acids 21 to 82 (62 residues), 39.2 bits, see alignment E=6.4e-13 PF13176: TPR_7" amino acids 48 to 79 (32 residues), 19.2 bits, see alignment (E = 8.5e-07) PF07719: TPR_2" amino acids 147 to 175 (29 residues), 24 bits, see alignment (E = 2.6e-08) PF13489: Methyltransf_23" amino acids 244 to 378 (135 residues), 33.1 bits, see alignment E=4.2e-11 PF13649: Methyltransf_25" amino acids 246 to 335 (90 residues), 42.3 bits, see alignment E=9.3e-14 PF13847: Methyltransf_31" amino acids 246 to 340 (95 residues), 31.3 bits, see alignment E=1.4e-10 PF08241: Methyltransf_11" amino acids 247 to 339 (93 residues), 38.6 bits, see alignment E=1.3e-12 PF08242: Methyltransf_12" amino acids 247 to 337 (91 residues), 42.2 bits, see alignment E=1e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>GFF448 hypothetical protein (Hydrogenophaga sp. GW460-11-11-14-LB1)
MSNATDPTEQAKAFFFEGNTLFEADRLDEALGRYQAALALVPGRPSILANLGVTQCRLGR
WPEAVATLAQATKADPTHRDAWIALGLSHEALSNWAAAADALQQGVRLGASTPQLHLSLA
MCLLRLERPGEALRSLDQALALDPTLAEAWSQRGSLMREAGQLAEAARCFEQALAHGGDE
TLHRFYLASVRAGEAAPAQPPSDYVEALFDDYADDFQHHLVHQLKYQAHETLLAPLRVGG
RRYPLVLDLGCGTGLCGQLIRPHADAVDGVDLAKAMVDQARAGGAYRRVEQGELLAFLRS
QDAAADLVIAADVFIYVGALDEVFAAVRRRLTPAGCFAFSVELAGDGQDLQLRPSLRYAH
SPAYIDRLARAHGFRVRQTWQAPLREDQQKPVMGLYALLEPATQA