Protein Info for GFF4478 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: PTS system, mannose-specific IID component (EC 2.7.1.69)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 transmembrane" amino acids 79 to 94 (16 residues), see Phobius details amino acids 125 to 147 (23 residues), see Phobius details amino acids 152 to 173 (22 residues), see Phobius details amino acids 196 to 217 (22 residues), see Phobius details amino acids 237 to 258 (22 residues), see Phobius details amino acids 264 to 283 (20 residues), see Phobius details PF03613: EIID-AGA" amino acids 22 to 284 (263 residues), 354.6 bits, see alignment E=1.5e-110

Best Hits

Swiss-Prot: 39% identical to PTRD_KLEPN: PTS system sorbose-specific EIID component (sorM) from Klebsiella pneumoniae

KEGG orthology group: K02796, PTS system, mannose-specific IID component (inferred from 99% identity to ses:SARI_02363)

MetaCyc: 51% identical to fructoselysine/glucoselysine PTS enzyme IID component (Salmonella enterica enterica serovar Typhimurium str. 14028S)
2.7.1.-; 2.7.1.-

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>GFF4478 PTS system, mannose-specific IID component (EC 2.7.1.69) (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MSEVTQTLIDDAQAHSQSESRITARDLRSVFWRSFTLQGSWNYERQQHMGYAFAMSPALK
RIYQDPAELGRALQRHLVLFNTTPHLSTFVFGLSIAMEEENQRNPDFNEESINAVKTSLM
GPLAGIGDSIFWGSLKVIAAGMGIYFAQQGSILGPILALLVYNIPHILCRWYALKLGYRA
GTTWLMRLWQSGLMDRVTYIASIVGLMVVGAMTASMIDITTPLSFTAGQTTMKVQDFIDK
ILPSLLPLLFTLGMYKLIRKGVNINWILLGTVVFGLLASALGLL