Protein Info for PS417_22910 in Pseudomonas simiae WCS417

Annotation: tRNA (guanine-N1)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR00088: tRNA (guanine(37)-N(1))-methyltransferase" amino acids 5 to 235 (231 residues), 332.1 bits, see alignment E=7.4e-104 PF01746: tRNA_m1G_MT" amino acids 26 to 223 (198 residues), 216.5 bits, see alignment E=1.5e-68

Best Hits

Swiss-Prot: 100% identical to TRMD_PSEFS: tRNA (guanine-N(1)-)-methyltransferase (trmD) from Pseudomonas fluorescens (strain SBW25)

KEGG orthology group: K00554, tRNA (guanine-N1-)-methyltransferase [EC: 2.1.1.31] (inferred from 100% identity to pfs:PFLU5010)

MetaCyc: 69% identical to tRNA m1G37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12458 [EC: 2.1.1.228]

Predicted SEED Role

"tRNA (Guanine37-N1) -methyltransferase (EC 2.1.1.31)" in subsystem Ribosome biogenesis bacterial or Wyeosine-MimG Biosynthesis (EC 2.1.1.31)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.228 or 2.1.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U8G7 at UniProt or InterPro

Protein Sequence (250 amino acids)

>PS417_22910 tRNA (guanine-N1)-methyltransferase (Pseudomonas simiae WCS417)
MANLRIEVISLFPEMFSAISEYGITSRAVKQGLLQLTCWNPRDYTTDRHHTVDDRPFGGG
PGMVMKIKPLEDALVQAKAAAGEKAKVIYLSPQGRQLKQAGVRELANEEALILIAGRYEG
IDERFIEAHVDEEWSIGDYVLSGGELPAMVLIDAVTRLLPGALGHADSAEEDSFTDGLLD
CPHYTRPEVYADQRVPDVLLSGNHAHIRRWRLQQSLGRTYERRADLLESRSLSGEEKKLL
EEYILARDDS