Protein Info for GFF4473 in Variovorax sp. SCN45

Annotation: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 71 to 83 (13 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details TIGR01133: undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase" amino acids 7 to 345 (339 residues), 316.8 bits, see alignment E=8.5e-99 PF03033: Glyco_transf_28" amino acids 7 to 144 (138 residues), 117.5 bits, see alignment E=4.9e-38 PF04101: Glyco_tran_28_C" amino acids 183 to 343 (161 residues), 126 bits, see alignment E=1.6e-40

Best Hits

Swiss-Prot: 77% identical to MURG_POLSJ: UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (murG) from Polaromonas sp. (strain JS666 / ATCC BAA-500)

KEGG orthology group: K02563, UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC: 2.4.1.227] (inferred from 95% identity to vpe:Varpa_0979)

Predicted SEED Role

"UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227)" in subsystem Peptidoglycan Biosynthesis (EC 2.4.1.227)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.1.227

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>GFF4473 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape ptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase (EC 2.4.1.227) (Variovorax sp. SCN45)
MTGRTALVMAGGTGGHIFPGLAVAEALRERGWQVHWLGAPGSMEEKLVPPRGFAFEPVQF
GGVRGKGPLTLFLLPMKLLRAFWQSLGVVRRVRPDVLVGLGGYITFPGGMMGVLMGKPLV
LHEQNSVAGLANKVLAGVADRVFTAFPNVLKKAQWVGNPLREAFTSKADPATRFAGRTGP
LKLLVVGGSLGARGLNTVVPKALARIAPAMRPQVLHQSGAKQIDELRANYSAAGVDGELT
PFIEDTAQAYADADIIVARAGASTVTEIAAVGAAALFVPFPSAVDDHQTTNARFLVDAGG
GWLVQQADLTPELLADLLQNTERTALIDKAAKAKTMQKTEAVEAVVRACEELAK