Protein Info for GFF4473 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details PF02669: KdpC" amino acids 29 to 206 (178 residues), 215.8 bits, see alignment E=2.1e-68 TIGR00681: K+-transporting ATPase, C subunit" amino acids 39 to 207 (169 residues), 166.7 bits, see alignment E=2.8e-53

Best Hits

Swiss-Prot: 54% identical to KDPC_XANOM: Potassium-transporting ATPase KdpC subunit (kdpC) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 77% identity to pap:PSPA7_3714)

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (214 amino acids)

>GFF4473 Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1) (Hydrogenophaga sp. GW460-11-11-14-LB1)
MTMTSTLTVNARKADADHPTVAGRGTWRGAIGLTILSLAGFGFLYSLAGVGVGQALFPKT
ANGSLIERDGKVIGSELVAQPFVSDTYFQSRPSAAGYNTMSLAGSNQARTNPDMRKRLEE
TRAAIAQREGVEPSAVPGDLFTQSGGGIDPHISPDGAAIQIERVARARGLERSAVERLVA
AHTDSQQLGVFGQARVHVLNLNLALDALNAPARK