Protein Info for PS417_22885 in Pseudomonas simiae WCS417

Annotation: homoserine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF03447: NAD_binding_3" amino acids 10 to 127 (118 residues), 80.1 bits, see alignment E=5.4e-26 PF00742: Homoserine_dh" amino acids 135 to 313 (179 residues), 220.5 bits, see alignment E=3.6e-69 PF01842: ACT" amino acids 352 to 416 (65 residues), 51.6 bits, see alignment E=1.6e-17 PF22629: ACT_AHAS_ss" amino acids 354 to 422 (69 residues), 40.6 bits, see alignment E=5.8e-14

Best Hits

Swiss-Prot: 89% identical to DHOM_PSEAE: Homoserine dehydrogenase (hom) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00003, homoserine dehydrogenase [EC: 1.1.1.3] (inferred from 100% identity to pfs:PFLU5006)

Predicted SEED Role

"Homoserine dehydrogenase (EC 1.1.1.3)" in subsystem Methionine Biosynthesis or Threonine and Homoserine Biosynthesis (EC 1.1.1.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7U646 at UniProt or InterPro

Protein Sequence (434 amino acids)

>PS417_22885 homoserine dehydrogenase (Pseudomonas simiae WCS417)
MKPVKVGICGLGTVGGGTFNVLQRNAEEISRRAGRGIEVAQIATRSPKPQFETTGIAITN
DVFAVATNPEIDIVIELVGGYTVARELVLKAIENGKHVVTANKALIAVHGNEIFAKAREK
GVIVAFEAAVAGGIPVIKAIREGLSANRINWVAGIINGTGNFILTEMREKGRTFEDVLAE
AQALGYAEADPTFDVEGIDAAHKLTILASIAFGIPLQFDKAYTEGITKLTTADVNYAEAL
GYRIKHLGVARSTPAGIELRVHPTLIPADRLIANVNGVMNAVMVNGDAAGSTLFYGAGAG
MEPTASSVIADLVDVVRAMTSDPENRVPHLAFQPDSLSAHPILPIEACESAYYLRIQAQD
HPGVLAQVASILSERGINIESIMQKEVEEQNGQVPMILLTHRVLEQHINDAIAALEALQG
VVGPVVRIRVEHLN