Protein Info for GFF4471 in Variovorax sp. SCN45

Annotation: D-alanine--D-alanine ligase (EC 6.3.2.4)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01205: D-alanine--D-alanine ligase
  • amino acids 11 to 314 (304 residues), 327.1 bits, E=4.9e-102
• PF01820: Dala_Dala_lig_N
  • amino acids 59 to 93 (35 residues), 41.7 bits, 3.2e-14
• PF02655: ATP-grasp_3
  • amino acids 102 to 282 (181 residues), 31.9 bits, E=2.8e-11
• PF02786: CPSase_L_D2
  • amino acids 108 to 283 (176 residues), 20.8 bits, E=4.7e-08
• PF07478: Dala_Dala_lig_C
  • amino acids 110 to 311 (202 residues), 199.7 bits, E=7.7e-63

Best Hits

Swiss-Prot: 77% identical to DDL_METPP: D-alanine--D-alanine ligase (ddl) from Methylibium petroleiphilum (strain ATCC BAA-1232 / LMG 22953 / PM1)

KEGG orthology group: K01921, D-alanine-D-alanine ligase [EC: 6.3.2.4] (inferred from 92% identity to vap:Vapar_0921)

MetaCyc: 51% identical to D-alanine--D-alanine ligase B (Escherichia coli K-12 substr. MG1655)
D-alanine--D-alanine ligase. [EC: 6.3.2.4]

Predicted SEED Role

"D-alanine--D-alanine ligase (EC 6.3.2.4)" in subsystem Peptidoglycan Biosynthesis (EC 6.3.2.4)

MetaCyc Pathways

• peptidoglycan biosynthesis I (meso-diaminopimelate containing) (11/12 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis I (meso-diaminopimelate containing) (8/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis II (lysine-containing) (7/8 steps found)
• UDP-N-acetylmuramoyl-pentapeptide biosynthesis III (meso-diaminopimelate containing) (6/8 steps found)
• peptidoglycan biosynthesis III (mycobacteria) (11/15 steps found)
• peptidoglycan biosynthesis II (staphylococci) (12/17 steps found)
• peptidoglycan biosynthesis IV (Enterococcus faecium) (12/17 steps found)
• peptidoglycan biosynthesis V (β-lactam resistance) (11/17 steps found)

KEGG Metabolic Maps

• D-Alanine metabolism
• Peptidoglycan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.4

Protein Sequence (323 amino acids)

>GFF4471 D-alanine--D-alanine ligase (EC 6.3.2.4) (Variovorax sp. SCN45)
MSLQDPKLFGKVAVLFGGSSAEREISLMSGTGVLEALRSRGVDAHAFDPSQRELADLKRE
GFARCFVALHGRHGEDGTVQGALELLGIPYTGSGVMASSVAMDKVMTKRIWQADGLPTPK
YVRLAFDQQSREQIMAVPDVLGLPLIVKPPREGSSIGVTKVEGYSQMQDAITLSAKYDAD
VLCEEFIEGEEVTCAVLGHGLDARALPVVRIAAPEGAYDYQNKYFTDDVKYQCPSGLPDA
EEHEIQRIALAAYRTLGCRGWGRADVMIRASDRKPFLLEMNTSPGMTSHSLVPMSARAAG
IAYEELCVRVLASATLDATGGSL