Protein Info for GFF447 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Inner membrane protein YiaH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 66 (18 residues), see Phobius details amino acids 77 to 98 (22 residues), see Phobius details amino acids 114 to 134 (21 residues), see Phobius details amino acids 143 to 160 (18 residues), see Phobius details amino acids 172 to 190 (19 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 267 to 288 (22 residues), see Phobius details amino acids 303 to 321 (19 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 5 to 318 (314 residues), 162.7 bits, see alignment E=6e-52

Best Hits

Swiss-Prot: 82% identical to WECH_ECOLI: O-acetyltransferase WecH (wecH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to sei:SPC_3737)

Predicted SEED Role

"Inner membrane protein YiaH"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>GFF447 Inner membrane protein YiaH (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MQPKINWIDNLRGIACLMVVMIHTTTWYITNAHSVSPLNWDIANVLNSASRVSVPLFFMI
SGYLFFGERCAQPRHFLRIALCLIFYSVVALAYISLFTSINVELSLKNVLQKPVFYHLWF
FFAITVIYLVSPLIQVKNVSGKMLLMLMVIIGIIANPNTVPQKIGGVEWLPINLYISGDT
FYYILYGILGRAIGMMETQKSSLTLICTALFIIAVFVISRGTLHELRWRGNFADTWYLYC
GPMVFICAVSLFTVVKNKLNARTLPGLGLISRHSLGIYGFHALIIHALRTNGLELKRWPP
LDIVWVFAATVTGSLLLSMLLQRIDKRKWVS