Protein Info for GFF4468 in Variovorax sp. SCN45

Annotation: Cell division protein FtsZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 TIGR00065: cell division protein FtsZ" amino acids 9 to 324 (316 residues), 371.8 bits, see alignment E=2.1e-115 PF00091: Tubulin" amino acids 16 to 173 (158 residues), 152.7 bits, see alignment E=1.5e-48 PF12327: FtsZ_C" amino acids 222 to 317 (96 residues), 95.1 bits, see alignment E=2.5e-31

Best Hits

Swiss-Prot: 55% identical to FTSZ_PSEAE: Cell division protein FtsZ (ftsZ) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03531, cell division protein FtsZ (inferred from 96% identity to vap:Vapar_0924)

Predicted SEED Role

"Cell division protein FtsZ (EC 3.4.24.-)" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>GFF4468 Cell division protein FtsZ (Variovorax sp. SCN45)
MTIEMIEVEEFNQGTQIKVIGVGGGGGNAVAHMMERGVQGVQFVCANTDAQALQRSTAHK
IIQLGTSGLGAGSKPEKGRDAAEAAVDDIRAAIDGAHMLFITAGMGGGTGTGAAPVIARV
AKEMGILTVGVVTKPFDWEGGRRMTNADAGLTELEANVDSLIVVLNEKLLDVLGEDVTQD
EAFAQANDVLKNAVGGISEIINEYGGVNVDFEDVRTVMGEPGKAMMGTAAAAGPDRARIA
AEQAVACPLLEGIDLSGAKGVLVLVTASKGSLKLNESKLAMNTIRAYASPDAHVIYGAAY
DDSLGDEMRVTVVATGLSRADARRQAPTLEVIRTGTDNIGFTVPTLGGTGHAHSSGGSQP
NYDGMAVPSVWRTNRTMAAAKVDALSSGGMDDFEIPAFLRRQAD