Protein Info for GFF4462 in Hydrogenophaga sp. GW460-11-11-14-LB1

Annotation: Serine phosphatase RsbU, regulator of sigma subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 402 PF00072: Response_reg" amino acids 18 to 129 (112 residues), 99.9 bits, see alignment E=1e-32 PF07228: SpoIIE" amino acids 197 to 392 (196 residues), 132.1 bits, see alignment E=2.5e-42

Best Hits

KEGG orthology group: None (inferred from 48% identity to cag:Cagg_2467)

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (402 amino acids)

>GFF4462 Serine phosphatase RsbU, regulator of sigma subunit (Hydrogenophaga sp. GW460-11-11-14-LB1)
MPTPDAPLKEPPERPMRILVVDDLALNRDLLARRIQRLGHEAGIAVNGRDALEQLDRQDW
DLVLLDITMPEMDGYETLSRIRASPLSAQLPVVMVSAIDETESVVRCLELGADDYLPKPF
NPVVLQARIESSLAKKRLQDHKSQLLQALSRELQIGQRIQQGFLPLQLPGLAGWSLGASC
TPARQVGGDFYDAYVLPGGALAIVVADVCDKGVGAALYMALFRTLLRAMATQAAPDEPLP
QTLVRSVAFVNDYIAGVHGHENMFATVFFALLEPDSGRLHYLNAGHEAPYVQPAQGASPV
RLGITGPAVGLEAGRRCTVESLTLQQGDGLLVYTDGVSEALGASGPFGEAALGRALSGDV
ACAQGLVDAVRTQLAAHVGGFEPHDDVTLFCLVREPSERIGA