Protein Info for PS417_22830 in Pseudomonas simiae WCS417

Annotation: DNA polymerase IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 PF00817: IMS" amino acids 9 to 156 (148 residues), 181.4 bits, see alignment E=2e-57 PF11798: IMS_HHH" amino acids 168 to 199 (32 residues), 27.5 bits, see alignment (E = 5e-10) PF21999: IMS_HHH_1" amino acids 183 to 232 (50 residues), 33.4 bits, see alignment 1e-11 PF11799: IMS_C" amino acids 242 to 349 (108 residues), 48.4 bits, see alignment E=2.3e-16

Best Hits

Swiss-Prot: 90% identical to DPO4_PSEPF: DNA polymerase IV (dinB) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K02346, DNA polymerase IV [EC: 2.7.7.7] (inferred from 99% identity to pfs:PFLU4996)

MetaCyc: 53% identical to DNA polymerase IV (Escherichia coli K-12 substr. MG1655)
DNA-directed DNA polymerase. [EC: 2.7.7.7]; 2.7.7.7 [EC: 2.7.7.7]

Predicted SEED Role

"DNA polymerase IV (EC 2.7.7.7)" in subsystem DNA repair, bacterial (EC 2.7.7.7)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.7

Use Curated BLAST to search for 2.7.7.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1N7UKB8 at UniProt or InterPro

Protein Sequence (352 amino acids)

>PS417_22830 DNA polymerase IV (Pseudomonas simiae WCS417)
MTQRKIIHVDCDCFYAAIEMRDDPSLAQKPLAVGGSADRRGVIATCNYEARAYGVRSAMS
SRHALKLCPDLTIVKPRMEAYKEASKEIQTIFRDYTDLIEPLSLDEAYLDVSDSSHFGGS
ATRIAQDIRRRVSNQLHITVSAGVAPNKFLAKIASDWKKPNGLFVITPDQVEDFVSQLRV
SKLHGVGKVTADKLARLGIEDCLQLREWNKLALVREFGSFGERLWSLARGIDDRVVQNDS
RRQSISVENTYDVDLPDLSSCLAKLPELMETLAGRMARIDSSYRAGKPFVKVKFHDFTQT
TLEQAGAGRDLESYQQLLTQAFNRGGKPVRLLGIGVRLLDLSNGNEQLEFSW