Protein Info for GFF4460 in Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868

Annotation: Putative inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 104 to 121 (18 residues), see Phobius details amino acids 133 to 151 (19 residues), see Phobius details amino acids 158 to 191 (34 residues), see Phobius details amino acids 197 to 215 (19 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 304 to 324 (21 residues), see Phobius details amino acids 330 to 353 (24 residues), see Phobius details PF19528: DUF6056" amino acids 1 to 414 (414 residues), 217.5 bits, see alignment E=1.5e-68

Best Hits

KEGG orthology group: None (inferred from 100% identity to seh:SeHA_C0667)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>GFF4460 Putative inner membrane protein (Salmonella enterica subsp. enterica serovar Typhimurium str. MS1868)
MVNNRLKMVIAILIVFSLVYSIGFITPMNSDDYTYALRELSLSSVKMHYLGWSGRVVSDT
ISTSLLKFFSPHIYNAINSAALTLMVLCWTMIPATLTKSSPSPYVMIFLFFLYFVANPAL
GQTNFWLVGSANYLWTNMFIAIYILISIYLSNGKKSNLILFVYAISSIFAGCSNENTSLV
VVLISVAYFFIMNRNKYLLIGVFGSAIGAGVLLLAPGNLSRASTIQDWYNQPLAWRVLEH
FSERLPSAMGAYWQVYIAFIILLISVVLSRNSSSKLMFGSFLFMLGAIAANVAFLASPAM
PSRALNGALCFMILSISFVAHSAFTKFNKASIYLSVTTYAMAFLYFIPSYILYYSSIKSI
SKQTEIREEIIDRAKHNKQDQAIIPDYYFPPVLHAGPSLDTFNSEAMSRYYGIDLKITAP
GFFDYSRAFNFKPLNINAKICNNVYIKSLWIYKQQMGIKTFVIFEFNKNPADSLDENTAM
FISFKTKDGKIINADVDKKTFQIDGRWLSGRAINGIDSNELESITSGTWDVRTGARTNEN
ITEIIK