Protein Info for GFF446 in Variovorax sp. SCN45

Annotation: Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 14 to 39 (26 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 124 to 146 (23 residues), see Phobius details amino acids 153 to 175 (23 residues), see Phobius details amino acids 193 to 218 (26 residues), see Phobius details amino acids 242 to 271 (30 residues), see Phobius details amino acids 285 to 307 (23 residues), see Phobius details amino acids 313 to 331 (19 residues), see Phobius details PF01032: FecCD" amino acids 34 to 333 (300 residues), 251.3 bits, see alignment E=6.2e-79

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 91% identity to vpe:Varpa_3375)

Predicted SEED Role

"Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1)" (TC 3.A.1.14.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (341 amino acids)

>GFF446 Iron(III) dicitrate transport system permease protein FecD (TC 3.A.1.14.1) (Variovorax sp. SCN45)
VSAAHRHTAHLRRVLLLGLGLLVLGAGAMLLGLGIGSTGFESLLLARHDPVALQIVWDIR
LPRTLGAWLAGALLGLAGSVAQGLFRNPLADPYLLGSASGASLGVALALLMFGGSAASTQ
WVMRLGLTGAAFVGAVVAVMLTLLLARGVQQTLRLLLAGVIVGVVLGAAKDLITIASADI
LQAIQGFILGSTGLVGWSACAVMAMVGAVCLLLGWALAPVLDGLALGEATARSLGLPLGA
MRAALVVVLALATGAAVAQTGLIAFVGLAAPHLVRSAVKTTHARLIVLSALMGGLLLMSA
DLLARWLIAPQELPVGVLTAVLGGSYLLWLMHRRGARGGVA